gget
CLI/Python toolkit for rapid bioinformatics queries. Preferred for quick BLAST searches. Access to 20+ databases: gene info (Ensembl/UniProt), AlphaFold, ARCHS4, Enrichr, OpenTargets, COSMIC, genome downloads. For advanced BLAST/batch processing, use biopython. For multi-database integration, use bioservices.
What this skill does
# gget
## Overview
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
**Important**: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
## Installation
Install gget in a clean virtual environment to avoid conflicts:
```bash
# Using uv (recommended)
uv pip install gget
# Or using pip
pip install --upgrade gget
# In Python/Jupyter
import gget
```
## Quick Start
Basic usage pattern for all modules:
```bash
# Command-line
gget <module> [arguments] [options]
# Python
gget.module(arguments, options)
```
Most modules return:
- **Command-line**: JSON (default) or CSV with `-csv` flag
- **Python**: DataFrame or dictionary
Common flags across modules:
- `-o/--out`: Save results to file
- `-q/--quiet`: Suppress progress information
- `-csv`: Return CSV format (command-line only)
## Module Categories
### 1. Reference & Gene Information
#### gget ref - Reference Genome Downloads
Retrieve download links and metadata for Ensembl reference genomes.
**Parameters**:
- `species`: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
- `-w/--which`: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all
- `-r/--release`: Ensembl release number (default: latest)
- `-l/--list_species`: List available vertebrate species
- `-liv/--list_iv_species`: List available invertebrate species
- `-ftp`: Return only FTP links
- `-d/--download`: Download files (requires curl)
**Examples**:
```bash
# List available species
gget ref --list_species
# Get all reference files for human
gget ref homo_sapiens
# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
```
```python
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)
```
#### gget search - Gene Search
Locate genes by name or description across species.
**Parameters**:
- `searchwords`: One or more search terms (case-insensitive)
- `-s/--species`: Target species (e.g., 'homo_sapiens', 'mouse')
- `-r/--release`: Ensembl release number
- `-t/--id_type`: Return 'gene' (default) or 'transcript'
- `-ao/--andor`: 'or' (default) finds ANY searchword; 'and' requires ALL
- `-l/--limit`: Maximum results to return
**Returns**: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
**Examples**:
```bash
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric
# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
```
```python
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
```
#### gget info - Gene/Transcript Information
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
**Parameters**:
- `ens_ids`: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
- `-n/--ncbi`: Disable NCBI data retrieval
- `-u/--uniprot`: Disable UniProt data retrieval
- `-pdb`: Include PDB identifiers (increases runtime)
**Returns**: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
**Examples**:
```bash
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
# Include PDB IDs
gget info ENSG00000034713 -pdb
```
```python
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
```
#### gget seq - Sequence Retrieval
Fetch nucleotide or amino acid sequences for genes and transcripts.
**Parameters**:
- `ens_ids`: One or more Ensembl identifiers
- `-t/--translate`: Fetch amino acid sequences instead of nucleotide
- `-iso/--isoforms`: Return all transcript variants (gene IDs only)
**Returns**: FASTA format sequences
**Examples**:
```bash
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853
# Get all protein isoforms
gget seq -t -iso ENSG00000034713
```
```python
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
```
### 2. Sequence Analysis & Alignment
#### gget blast - BLAST Searches
BLAST nucleotide or amino acid sequences against standard databases.
**Parameters**:
- `sequence`: Sequence string or path to FASTA/.txt file
- `-p/--program`: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
- `-db/--database`:
- Nucleotide: nt, refseq_rna, pdbnt
- Protein: nr, swissprot, pdbaa, refseq_protein
- `-l/--limit`: Max hits (default: 50)
- `-e/--expect`: E-value cutoff (default: 10.0)
- `-lcf/--low_comp_filt`: Enable low complexity filtering
- `-mbo/--megablast_off`: Disable MegaBLAST (blastn only)
**Examples**:
```bash
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
```
```python
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
```
#### gget blat - BLAT Searches
Locate genomic positions of sequences using UCSC BLAT.
**Parameters**:
- `sequence`: Sequence string or path to FASTA/.txt file
- `-st/--seqtype`: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
- `-a/--assembly`: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)
**Returns**: genome, query size, alignment positions, matches, mismatches, alignment percentage
**Examples**:
```bash
# Find genomic location in human
gget blat ATCGATCGATCGATCG
# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
```
```python
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
```
#### gget muscle - Multiple Sequence Alignment
Align multiple nucleotide or amino acid sequences using Muscle5.
**Parameters**:
- `fasta`: Sequences or path to FASTA/.txt file
- `-s5/--super5`: Use Super5 algorithm for faster processing (large datasets)
**Returns**: Aligned sequences in ClustalW format or aligned FASTA (.afa)
**Examples**:
```bash
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa
# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
```
```python
# Python
gget.muscle("sequences.fasta", save=True)
```
#### gget diamond - Local Sequence Alignment
Perform fast local protein or translated DNA alignment using DIAMOND.
**Parameters**:
- Query: Sequences (string/list) or FASTA file path
- `--reference`: Reference sequences (string/list) or FASTA file path (required)
- `--sensitivity`: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
- `--threads`: CPU threads (default: 1)
- `--diamond_db`: Save database for reuse
- `--translated`: Enable nucleotide-to-amino acid alignment
**Returns**: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
**Examples**:
```bash
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
```
```python
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
```
### 3. Structural & Protein Analysis
#### gget pdb - Protein Structures
Query RCSB Protein Data Bank for structure and metadata.
**Parameters**:
- `pdb_id`: PDB identifier (e.g., '7S7U')
- `-r/--resource`: Data type (pdb, entry, pubmed, assembly, entity types)
- `-i/--identifier`: Assembly, entity, or chain ID
**Returns**: PDB format (structures) or JSON (metadata)
**Examples**:
```bash
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb
# Get metadata
gget pdb 7S7U -r entry
```
```python
# Python
gget.pdb("7S7U", save=TrueRelated in General
modeling-omnistudio-epc-catalog
IncludedSalesforce Industries CME EPC product-modeling skill for Product2-based catalog creation. Use when creating EPC products, configuring product attributes, building offer bundles with Product Child Items, or reviewing EPC DataPack JSON metadata for product catalog changes. TRIGGER when: user creates or updates Product2 EPC records, AttributeAssignment payloads, AttributeMetadata/AttributeDefaultValues, Offer bundles, or ProductChildItem relationships. DO NOT TRIGGER when: designing OmniScripts/FlexCards/Integration Procedures (use building-omnistudio-omniscript, building-omnistudio-flexcard, or building-omnistudio-integration-procedure), implementing Apex business logic (use generating-apex), or troubleshooting deployment pipelines (use deploying-metadata).
relationship-science-coach
IncludedUse this skill for direct, practical adult relationship coaching: couples conflict, repair, trust, marriage, dating, flirting, attachment patterns, emotional connection, sex, desire differences, eroticism, kink negotiation, affection, love languages, breakups, and long-term passion. Draw on Gottman, EFT and Hold Me Tight, attachment science, modern sex research, Perel, Nagoski, Kerner, Schnarch, Love and Stosny, and flexible love-language tools. Be concrete and low-hedge. Redirect only for imminent danger, abuse, coercive control, minors, non-consent, self-harm, stalking, or medical/legal/psychiatric decisions.
building-sf-integrations
IncludedSalesforce integration architecture and runtime plumbing with 120-point scoring. Use this skill to set up Named Credentials, External Credentials, External Services, REST/SOAP callout patterns, Platform Events, and Change Data Capture. TRIGGER when: user sets up Named Credentials, External Services, REST/SOAP callouts, Platform Events, CDC, or touches .namedCredential-meta.xml files. DO NOT TRIGGER when: Connected App/OAuth config (use configuring-connected-apps), Apex-only logic (use generating-apex), or data import/export (use handling-sf-data).
venue-templates
IncludedAccess comprehensive LaTeX templates, formatting requirements, and submission guidelines for major scientific publication venues (Nature, Science, PLOS, IEEE, ACM), academic conferences (NeurIPS, ICML, CVPR, CHI), research posters, and grant proposals (NSF, NIH, DOE, DARPA). This skill should be used when preparing manuscripts for journal submission, conference papers, research posters, or grant proposals and need venue-specific formatting requirements and templates.
let-fate-decide
IncludedDraws the 12 Houses of the Zodiac Tarot spread to inject entropy into planning when prompts are vague, ambiguous, or casually delegated. Interprets the spread to guide next steps. Use when the user says 'let fate decide', 'YOLO', 'whatever', 'idk', or other nonchalant phrases, makes Yu-Gi-Oh references, or when you are about to arbitrarily pick between multiple reasonable approaches. Prefer over ask-questions-if-underspecified when the user's tone is casual or playful rather than precision-seeking.
net-ops
IncludedCross-platform network troubleshooting (Windows, macOS, Linux) via local or remote shell. Use for: DNS broken, can't resolve hostnames, nslookup/dig works but apps fail, NRPT, WFP, scutil, /etc/resolver, systemd-resolved, /etc/resolv.conf, NetworkManager, VPN DNS leak residue (ProtonVPN/Mullvad/WireGuard/AnyConnect), AV/firewall blocking DNS or DoH, Tailscale DNS interaction, intermittent connectivity, remote diagnostics over SSH.